HPA000690

SF3A1 antibody from Sigma-Aldrich
Prp21, PRPF21, SAP114, SF3a120
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000690
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000690, RRID:AB_1079933
Product name
Anti-SF3A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000690
Antibody type
Polyclonal
Antigen
Splicing factor 3 subunit 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWK
LNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQK
LQYEGIFIKDSNSLAYYNMANGAVIHLALKESGGR
KK
Storage
-20C
Provider Type Product Number
- No reagents -