Antibody data

Product number
H00002958-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002958-M01, RRID:AB_1204445
Product name
GTF2A2 monoclonal antibody (M01), clone 2B9
Provider product page
Abnova Corporation - H00002958-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant GTF2A2.
Antigen sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQ
VLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDN
VWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGS
NTTE
Isotype
IgG
Antibody clone number
2B9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -