HPA012921

IGSF10 antibody from Sigma-Aldrich
CMF608, FLJ25972
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012921
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012921, RRID:AB_1851526
Product name
Anti-IGSF10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012921
Antibody type
Polyclonal
Antigen
Immunoglobulin superfamily member 10 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQITLPRAEMRPVKHKWTMISRDNNTKLEHTVLVG
GTVGLNCPGQGDPTPHVDWLLADGSKVRAPYVSED
GRILIDKSGKLELQMADSFDTGVYHCISSNYDDAD
ILTYRITVVEPLVEAYQENGIHHTVFIGETLDLPC
HSTGIP
Storage
-20C
Provider Type Product Number
- No reagents -