HPA012921

IGSF10 antibody from Atlas Antibodies
CMF608, FLJ25972
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012921
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012921, RRID:AB_1234560
Product name
Anti-IGSF10
Provider product page
Atlas Antibodies - HPA012921
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AQITLPRAEMRPVKHKWTMISRDNNTKLEHTVLVG
GTVGLNCPGQGDPTPHVDWLLADGSKVRAPYVSED
GRILIDKSGKLELQMADSFDTGVYHCISSNYDDAD
ILTYRITVVEPLVEAYQENGIHHTVFIGETLDLPC
HSTGIP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -