Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030646 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030646, RRID:AB_10602019
- Product name
- Anti-PGGT1B
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GAGLESHGGSTFCGIASLCLMGKLEEVFSEKELNR
IKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKL
LKIFQYTNFEKNRNYILSTQDRLVGGFAKWPDSHP
DALHAYFGICGLSLMEESGICKVHPALNVS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A Requirement of Protein Geranylgeranylation for Chemokine Receptor Signaling and Th17 Cell Function in an Animal Model of Multiple Sclerosis
Control of antiviral innate immune response by protein geranylgeranylation
Swan G, Geng J, Park E, Ding Q, Zhou J, Walcott C, Zhang J, Huang H, Hammer G, Wang D
Frontiers in Immunology 2021;12
Frontiers in Immunology 2021;12
Control of antiviral innate immune response by protein geranylgeranylation
Yang S, Harding A, Sweeney C, Miao D, Swan G, Zhou C, Jiang Z, Fitzgerald K, Hammer G, Bergo M, Kroh H, Lacy D, Sun C, Glogauer M, Que L, Heaton N, Wang D
Science Advances 2019;5(5)
Science Advances 2019;5(5)
No comments: Submit comment
No validations: Submit validation data