Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005229-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005229-M02, RRID:AB_530171
- Product name
- PGGT1B monoclonal antibody (M02), clone 5E4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PGGT1B.
- Antigen sequence
MVATEDERLAGSGEGERLDFLRDRHVRFFQRCLQV
LPERYSSLETSRLTIAFFALSGLDMLDSLDVVNKD
DIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPF- Isotype
- IgG
- Antibody clone number
- 5E4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Genetic studies on the functional relevance of the protein prenyltransferases in skin keratinocytes.
Lee R, Chang SY, Trinh H, Tu Y, White AC, Davies BS, Bergo MO, Fong LG, Lowry WE, Young SG
Human molecular genetics 2010 Apr 15;19(8):1603-17
Human molecular genetics 2010 Apr 15;19(8):1603-17
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PGGT1B monoclonal antibody (M02), clone 5E4 Western Blot analysis of PGGT1B expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PGGT1B monoclonal antibody (M02), clone 5E4. Western Blot analysis of PGGT1B expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PGGT1B is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PGGT1B on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PGGT1B on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol