HPA012922

ANKRD22 antibody from Sigma-Aldrich
MGC22805
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012922
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012922, RRID:AB_1844838
Product name
Anti-ANKRD22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012922
Antibody type
Polyclonal
Antigen
Ankyrin repeat domain-containing protein 22 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTKQNEALVRMLLDAGVEVNATDCYGCTALHYACE
MKNPSLIPLLLEARADPTIKNKHGESSLDIARRLK
FSQIELMLRK
Storage
-20C
Provider Type Product Number
- No reagents -