HPA032144

ABHD13 antibody from MilliporeSigma / Merck KGaA
bA153I24.2, BEM46L1, C13orf6, FLJ14906
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA032144
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA032144, RRID:AB_10602304
Product name
Anti-ABHD13 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA032144
Antibody type
Polyclonal
Antigen
abhydrolase domain containing 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKIFL
FGRSLGGAVAIHLASENSHRISAIMVENTFLSIPH
MASTLFSFFP
Storage
-20C
Provider Type Product Number
- No reagents -