Antibody data

Product number
ABIN405942
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 41 (ZNF41) antibody
Provider product page
antibodies-online - ABIN405942
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF41 antibody: synthetic peptide directed towards the C terminal of human ZNF41
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
LRVHQKIHTGEKPNICAECGKAFTDRSNLITHQKI
HTREK PYECGDCGKT
Vial size
50 µg
Provider Type Product Number
- No reagents -