HPA017140

LGI2 antibody from Sigma-Aldrich
FLJ10675, KIAA1916
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017140
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017140, RRID:AB_1852833
Product name
Anti-LGI2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017140
Antibody type
Polyclonal
Antigen
Leucine-rich repeat LGI family member 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLTHLSLANNHIKALPRDVFSDLDSLIELDLRGNK
FECDCKAKWLYLWLKMTNSTVSDVLCIGPPEYQEK
KLNDVTSFDYECTTTDFVVHQTLPYQSVSVDTFNS
KNDVYVAIAQPSMENCMVLEW
Storage
-20C
Provider Type Product Number
- No reagents -