HPA017140

LGI2 antibody from Atlas Antibodies
FLJ10675, KIAA1916
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017140
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017140, RRID:AB_1852833
Product name
Anti-LGI2
Provider product page
Atlas Antibodies - HPA017140
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DLTHLSLANNHIKALPRDVFSDLDSLIELDLRGNK
FECDCKAKWLYLWLKMTNSTVSDVLCIGPPEYQEK
KLNDVTSFDYECTTTDFVVHQTLPYQSVSVDTFNS
KNDVYVAIAQPSMENCMVLEW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -