HPA012657

PLA2R1 antibody from Sigma-Aldrich
CLEC13C, PLA2-R, PLA2G1R, PLA2IR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012657
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012657, RRID:AB_2299684
Product name
Anti-PLA2R1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012657
Antibody type
Polyclonal
Antigen
Secretory phospholipase A2 receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLL
GDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWH
TLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFY
ICKKAGHVLSDAESGCQEGWERHGGFCYKID
Storage
-20C
Provider Type Product Number
- No reagents -