HPA010642

DNAJB12 antibody from Atlas Antibodies
DJ10, FLJ20027
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010642
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010642, RRID:AB_888350
Product name
Anti-DNAJB12
Provider product page
Atlas Antibodies - HPA010642
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NKDEAERCISIALKAIQSNQPDRALRFLEKAQRLY
PTPRVRALIESLNQKPQTAGDQPPPTDTTHATHRK
AGGTDAPSANGEAGGESTKGYTAEQVAAVKRVKQC
K
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -