HPA010642

DNAJB12 antibody from Sigma-Aldrich
DJ10, FLJ20027
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010642
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010642, RRID:AB_1078692
Product name
Anti-DNAJB12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010642
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily B member 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKDEAERCISIALKAIQSNQPDRALRFLEKAQRLY
PTPRVRALIESLNQKPQTAGDQPPPTDTTHATHRK
AGGTDAPSANGEAGGESTKGYTAEQVAAVKRVKQC
K
Storage
-20C
Provider Type Product Number
- No reagents -