HPA055327

ATP6V0D2 antibody from Atlas Antibodies
ATP6D2, FLJ38708, VMA6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA055327
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055327, RRID:AB_2682784
Product name
Anti-ATP6V0D2
Provider product page
Atlas Antibodies - HPA055327
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVAD
HYGVYKPLFEAVGGSG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -