Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00245972-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00245972-M01, RRID:AB_605963
- Product name
- ATP6V0D2 monoclonal antibody (M01), clone 7A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ATP6V0D2.
- Antigen sequence
ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYG
VYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN- Isotype
- IgG
- Antibody clone number
- 7A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Bovine parathyroid hormone enhances osteoclast bone resorption by modulating V-ATPase through PTH1R.
Increased IL-6 expression in osteoclasts is necessary but not sufficient for the development of Paget's disease of bone.
Liu S, Zhu W, Li S, Ma J, Zhang H, Li Z, Zhang L, Zhang B, Li Z, Liang X, Shi W
International journal of molecular medicine 2016 Feb;37(2):284-92
International journal of molecular medicine 2016 Feb;37(2):284-92
Increased IL-6 expression in osteoclasts is necessary but not sufficient for the development of Paget's disease of bone.
Teramachi J, Zhou H, Subler MA, Kitagawa Y, Galson DL, Dempster DW, Windle JJ, Kurihara N, Roodman GD
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research 2014 Jun;29(6):1456-65
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research 2014 Jun;29(6):1456-65
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ATP6V0D2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol