Antibody data

Product number
H00084898-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084898-M01, RRID:AB_1578909
Product name
PLXDC2 monoclonal antibody (M01), clone 4G10
Provider product page
Abnova Corporation - H00084898-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PLXDC2.
Antigen sequence
DGKPGDQILDWQYGVTQAFPHTEEEVEVDSHAYSH
RWKRNLDFLKAVDTNRASVGQDSPEPRSFTDLLLD
DGQDNNTQIE
Isotype
IgG
Antibody clone number
4G10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -