Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- WH0051655M1 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Monoclonal Anti-RASD1 antibody produced in mouse
- Antibody type
- Monoclonal
- Antigen
- RASD1 (AAH18041, a.a. 1-110) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
- Description
- purified immunoglobulin
- Reactivity
- Human
- Antigen sequence
MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKV
GKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGE
VYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSL
DNRDS (without GST)- Isotype
- IgG
- Storage
- -20C
No comments: Submit comment
No validations: Submit validation data