HPA010533

ACMSD antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010533
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010533, RRID:AB_1844517
Product name
Anti-ACMSD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010533
Antibody type
Polyclonal
Antigen
2-amino-3-carboxymuconate-6-semialdehyde decarboxylase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRP
DLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTD
VIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEE
TKNKLKAGNAL
Storage
-20C
Provider Type Product Number
- No reagents -