Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310677 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein tyrosine Phosphatase, Receptor Type, R (PTPRR) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PTPRR antibody: synthetic peptide directed towards the C terminal of human PTPRR
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
NYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSA
QPLLQ LMLDVEEDRL- Vial size
- 50 µg
Submitted references Crystal structures and inhibitor identification for PTPN5, PTPRR and PTPN7: a family of human MAPK-specific protein tyrosine phosphatases.
Context based error modeling for lossless compression of EEG signals using neural networks.
Eswaran J, von Kries JP, Marsden B, Longman E, Debreczeni JE, Ugochukwu E, Turnbull A, Lee WH, Knapp S, Barr AJ
The Biochemical journal 2006 May 1;395(3):483-91
The Biochemical journal 2006 May 1;395(3):483-91
Context based error modeling for lossless compression of EEG signals using neural networks.
Sriraam N, Eswaran C
Journal of medical systems 2006 Dec;30(6):439-48
Journal of medical systems 2006 Dec;30(6):439-48
No comments: Submit comment
No validations: Submit validation data