HPA011851

PTPRR antibody from Sigma-Aldrich
EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011851
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011851, RRID:AB_1855939
Product name
Anti-PTPRR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011851
Antibody type
Polyclonal
Antigen
Receptor-type tyrosine-protein phosphatase R precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMD
VNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGK
KNSIELFVSPINRKTGISDALPSEEVLRSLNINVL
HQSLSQFGITEVSPEKNVLQGQHE
Storage
-20C
Provider Type Product Number
- No reagents -