HPA017167

DGKE antibody from MilliporeSigma / Merck KGaA
DAGK6, DGK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017167
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017167, RRID:AB_1847638
Product name
Anti-DGKE antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017167
Antibody type
Polyclonal
Antigen
Diacylglycerol kinase epsilon recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEG
CLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNV
PLCSYCMVCKQQCGCQPKLCDYRCIWCQKTVHDEC
MKNSLKNEKCDFGEFKNLIIPPSYL
Storage
-20C
Provider Type Product Number
- No reagents -