H00196074-B01

METTL15 antibody from Abnova Corporation
FLJ33979, METT5D1

Antibody data

Product number
H00196074-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00196074-B01, RRID:AB_1138606
Product name
METT5D1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00196074-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human METT5D1 protein.
Antigen sequence
MAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGH
TKAILQKESDIVLYALDRDPTAYALAEHLSELYPK
QIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGC
SSMQLDTPERGFSLRKDGSLDMRMDGGRSTGTCIY
PKNIRGGEACQENRFSNCSGTQHLPHHQNPAACQH
RCRSISSLCYLYTERLTTAIYPYCHQDFPGSSHIC
EQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -