HPA011393

CHST9 antibody from Sigma-Aldrich
GALNAC-4-ST2, GALNAC4ST-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011393
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011393, RRID:AB_1846733
Product name
Anti-CHST9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011393
Antibody type
Polyclonal
Antigen
Carbohydrate sulfotransferase 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGRVEKRREQKVTSGWGPVKYLRPVPRIMSTEKIQ
EHITNQNPKFHMPEDVREKKENLLLNSERSTRLLT
KTSHSQGGDQALSKSTGSPTEKLIEKRQGAKTVFN
KFSNMNWPVDIHPLNKSLVKDNKWKKTE
Storage
-20C
Provider Type Product Number
- No reagents -