H00001399-D01P

antibody from Abnova Corporation

Targeting: CRKL

Western blot (Supportive data in Antibodypedia)

Immunocytochemistry (Supportive data in Antibodypedia)

Proximity ligation assay (Supportive data in Antibodypedia)

Antibody Data

Product number

H00001399-D01P

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#H00001399-D01P, RRID:AB_1573192

Product name

CRKL purified MaxPab rabbit polyclonal antibody (D01P)

Antibody type

Polyclonal

Description

Rabbit polyclonal antibody raised against a full-length human CRKL protein.

Antigen sequence

MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGM
FLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR
FKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRY
PSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAE
DLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPV
PYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQP
QTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQK
RVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN
GRKGLFPFTHVKIFDPQNPDENE


Storage

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Submitted references

Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.

Liu CH, Chen TC, Chau GY, Jan YH, Chen CH, Hsu CN, Lin KT, Juang YL, Lu PJ, Cheng HC, Chen MH, Chang CF, Ting YS, Kao CY, Hsiao M, Huang CY
Molecular & cellular proteomics : MCP 2013 May;12(5):1335-49

Western blot

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

Western Blot analysis of CRKL expression in transfected 293T cell line (H00001399-T01) by CRKL MaxPab polyclonal antibody.Lane 1: CRKL transfected lysate(33.80 KDa).Lane 2: Non-transfected lysate.

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

CRKL MaxPab rabbit polyclonal antibody. Western Blot analysis of CRKL expression in A-431.

Immunocytochemistry

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

Immunofluorescence of purified MaxPab antibody to CRKL on HeLa cell. [antibody concentration 10 ug/ml]

Validation comment

Immunofluorescence

Protocol

Protocol

Proximity ligation assay

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

Proximity Ligation Analysis of protein-protein interactions between CRKL and SOS1. Huh7 cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-SOS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Validation comment

In situ Proximity Ligation Assay (Cell)

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

Proximity Ligation Analysis of protein-protein interactions between CRKL and EGFR. HeLa cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-EGFR mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Validation comment

In situ Proximity Ligation Assay (Cell)

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

Proximity Ligation Analysis of protein-protein interactions between CRKL and PTPN11. Mahlavu cells were stained with anti-CRKL rabbit purified polyclonal 1:600 and anti-PTPN11 mouse purified polyclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Validation comment

In situ Proximity Ligation Assay (Cell)