Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Proximity ligation assay [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001399-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001399-D01P, RRID:AB_1573192
- Product name
- CRKL purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human CRKL protein.
- Antigen sequence
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGM
FLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR
FKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRY
PSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAE
DLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPV
PYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQP
QTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQK
RVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN
GRKGLFPFTHVKIFDPQNPDENE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
Liu CH, Chen TC, Chau GY, Jan YH, Chen CH, Hsu CN, Lin KT, Juang YL, Lu PJ, Cheng HC, Chen MH, Chang CF, Ting YS, Kao CY, Hsiao M, Huang CY
Molecular & cellular proteomics : MCP 2013 May;12(5):1335-49
Molecular & cellular proteomics : MCP 2013 May;12(5):1335-49
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CRKL expression in transfected 293T cell line (H00001399-T01) by CRKL MaxPab polyclonal antibody.Lane 1: CRKL transfected lysate(33.80 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CRKL MaxPab rabbit polyclonal antibody. Western Blot analysis of CRKL expression in A-431.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to CRKL on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CRKL and SOS1. Huh7 cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-SOS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CRKL and EGFR. HeLa cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-EGFR mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CRKL and PTPN11. Mahlavu cells were stained with anti-CRKL rabbit purified polyclonal 1:600 and anti-PTPN11 mouse purified polyclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)