HPA011310

ROBO3 antibody from Sigma-Aldrich
FLJ21044, HGPPS, HGPS, RBIG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011310
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011310, RRID:AB_1856392
Product name
Anti-ROBO3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011310
Antibody type
Polyclonal
Antigen
Roundabout homolog 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGPVYSTIDPAGEELQTFHGGFPQHPSGDLGPWSQ
YAPPEWSQGDSGAKGGKVKLLGKPVQMPSLNWPEA
LPPPPPSCELSCLEGPEEELEGSSEPEEWCPPMPE
RSHLTE
Storage
-20C
Provider Type Product Number
- No reagents -