HPA012805

PLXDC1 antibody from Sigma-Aldrich
TEM3, TEM7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012805
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012805, RRID:AB_1857893
Product name
Anti-PLXDC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012805
Antibody type
Polyclonal
Antigen
Plexin domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEW
MDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYD
GDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNN
LSPKTKGTPVHLG
Storage
-20C
Provider Type Product Number
- No reagents -