H00115352-B01P

FCRL3 antibody from Abnova Corporation
CD307c, FCRH3, IFGP3, IRTA3, SPAP2, SPAP2a, SPAP2b, SPAP2c, SPAP2d, SPAP2e

Antibody data

Product number
H00115352-B01P
Provider
Abnova Corporation
Product name
FCRL3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00115352-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human FCRL3 protein.
Antigen sequence
MLLWLLLLILTPGREQSGVAPKAVLLLNPPWSTAF
KGEKVALICSSISHSLAQGDTYWYHDEKLLKIKHD
KIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQ
ALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQL
PNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIE
VTSKPLNIQVQELFLHPVLRASSSTPIEGSPMTLT
CETQLSPQRPDVQLQFSLFRDSQTLGLGWSRSPRL
QIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRV
QRVPVSNVNLEIRPTGGQLIEGENMVLICSVAQGS
GTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKE
SDAGRYYCAADNVHSPILSTWIRVTVRIPVSHPVL
TFRAPRAHTVVGDLLELHCESLRGSPPILYRFYHE
DVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADN
GLGAQHSHGVSLRVTVPVSRPVLTLRAPGAQAVVG
DLLELHCESLRGSFPILYWFYHEDDTLGNISAHSG
GGASFNLSLTTEHSGNYSCEADNGLGAQHSKVVTL
NVTGTSRNRTGLTAAGITGLVLSILVLAAAAALLH
YARARRKPGGLSATGTSSHSPSECQEPSSSRPSRI
DPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQI
WSIQHTKENSANCPMMHQEHEELTVLYSELKKTHP
DDSAGEASSRGRAHEEDDEENYENILNPRKNKVQD
FPCLCNT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -