HPA015508

FCRL3 antibody from Sigma-Aldrich
CD307c, FCRH3, IFGP3, IRTA3, SPAP2, SPAP2a, SPAP2b, SPAP2c, SPAP2d, SPAP2e
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015508
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015508, RRID:AB_1848482
Product name
Anti-FCRL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015508
Antibody type
Polyclonal
Antigen
Fc receptor-like protein 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPT
HSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHT
KENSANCPMMHQEHEELTVLYSELKKTHPDDSAGE
ASSRGRAHEEDDEENYENV
Storage
-20C
Provider Type Product Number
- No reagents -