H00128861-B01P

BPIFA3 antibody from Abnova Corporation
bA49G10.4, C20orf71, SPLUNC3

Antibody data

Product number
H00128861-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00128861-B01P, RRID:AB_1571846
Product name
C20orf71 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00128861-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C20orf71 protein.
Antigen sequence
MMCPLWRLLIFLGLLALPLAPHKQPWPGLAQAHRD
NKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASA
QVAPGLVGWLISGRKHQQQQESRSFDNNIVKMCAH
MSIVVEFWLEKDEFGRRDLVIGKCDAEPSSVHVAI
LTEAIPPKMNQFLYNLKENLQKVLPHMVESQVCPL
IGEILGQLDVKLLKSLIEQEAAHEPTHHETSQPSA
CQAGESPS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -