HPA010843

PAQR6 antibody from Sigma-Aldrich
FLJ22672, PRdelta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010843
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010843, RRID:AB_1079565
Product name
Anti-PAQR6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010843
Antibody type
Polyclonal
Antigen
Progestin and adipoQ receptor family member 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTYSLLLLSQPPCFGPPVHALCCRVAHWRGVPRPN
NSEAPSLTLSWRGQRPGPSADEEPRFGPNQVGTHL
SLEPTGAEERGHRREGREEEGCLGGLAECERDREG
ALDGSGRS
Storage
-20C
Provider Type Product Number
- No reagents -