HPA027786

CNBD1 antibody from Sigma-Aldrich
FLJ35802
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027786
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027786, RRID:AB_10600231
Product name
Anti-CNBD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027786
Antibody type
Polyclonal
Antigen
cyclic nucleotide binding domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AEMYLPSYDSMLSKWSTFGTLEVMPQNESETQMFS
VVTEDDCEILKIPAKGYAKIKEEKIKLENMQKLKL
IRMCPYYEEWPTLSIYELIALLKW
Storage
-20C
Provider Type Product Number
- No reagents -