Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449840 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-AT Rich Interactive Domain 3C (BRIGHT-Like) (ARID3C) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the C terminal of human ARID3C
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLA
GSGISSINMALEING- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references ARID proteins: a diverse family of DNA binding proteins implicated in the control of cell growth, differentiation, and development.
Wilsker D, Patsialou A, Dallas PB, Moran E
Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research 2002 Mar;13(3):95-106
Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research 2002 Mar;13(3):95-106
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HeLa; WB Suggested Anti-ARID3C Antibody Titration: 0.2-1 ug/ml. Positive Control: Hela cell lysate; ARID3C antibody - C-terminal region (AP43698PU-N) in Human HeLa cells using Western Blot