HPA010844

DHRS3 antibody from Atlas Antibodies
RDH17, retSDR1, Rsdr1, SDR1, SDR16C1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010844
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010844, RRID:AB_1234166
Product name
Anti-DHRS3
Provider product page
Atlas Antibodies - HPA010844
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TEKCLKETTEEIRQMGTECHYFICDVGNREEVYQT
AKAVREKVGDITILVNNAAVVHGKSLMDSDDDALL
KSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSV
LALSAIPG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -