HPA010844

DHRS3 antibody from Sigma-Aldrich
RDH17, retSDR1, Rsdr1, SDR1, SDR16C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010844
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010844, RRID:AB_1847653
Product name
Anti-DHRS3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010844
Antibody type
Polyclonal
Antigen
Short-chain dehydrogenase/reductase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEKCLKETTEEIRQMGTECHYFICDVGNREEVYQT
AKAVREKVGDITILVNNAAVVHGKSLMDSDDDALL
KSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSV
LALSAIPG
Storage
-20C
Provider Type Product Number
- No reagents -