Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA011397 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-WNT4
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVE
PRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFC
EQDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGF
HTAQVELAERCSCKFHWCCFVKCR- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Paternal nicotine exposure defines different behavior in subsequent generation via hyper-methylation of mmu-miR-15b
Further evidence of the involvement of the Wnt signaling pathway in Dupuytren’s disease
Dai J, Wang Z, Xu W, Zhang M, Zhu Z, Zhao X, Zhang D, Nie D, Wang L, Qiao Z
Scientific Reports 2017;7(1)
Scientific Reports 2017;7(1)
Further evidence of the involvement of the Wnt signaling pathway in Dupuytren’s disease
ten Dam E, van Beuge M, Bank R, Werker P
Journal of Cell Communication and Signaling 2015;10(1):33-40
Journal of Cell Communication and Signaling 2015;10(1):33-40
No comments: Submit comment
No validations: Submit validation data