HPA011397

WNT4 antibody from Sigma-Aldrich
WNT-4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011397
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011397, RRID:AB_1858854
Product name
Anti-WNT4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011397
Antibody type
Polyclonal
Antigen
Protein Wnt-4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVE
PRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFC
EQDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGF
HTAQVELAERCSCKFHWCCFVKCR
Storage
-20C
Provider Type Product Number
- No reagents -