HPA001078

APOL2 antibody from Sigma-Aldrich
APOL-II
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001078
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001078, RRID:AB_10602432
Product name
Anti-APOL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001078
Antibody type
Polyclonal
Antigen
apolipoprotein L, 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGVRVREEEAGTRVKENLPVWTVTGELQGKPLGNP
AAGTMNPESSIFIEDYLKYFQDQVSRENLLQLLTD
DEAWNGFVAAAELPRDEADELRKALNKLASHMVMK
DKNRHDKDQQHRQWFLKEFPRLKRELEDHIRKLRA
LAEEVEQVHR
Storage
-20C
Provider Type Product Number
- No reagents -