HPA058656

SGCB antibody from Atlas Antibodies
A3b, LGMD2E, SGC

Antibody data

Product number
HPA058656
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA058656, RRID:AB_2683790
Product name
Anti-SGCB
Provider product page
Atlas Antibodies - HPA058656
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTV
GGRRNENLVITGNNQPIVFQQGTTKLSVENNKTSI
TSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKS
LNVQKASTERITSNATSDLNIKVDGRAIVRGNEGV
FIMGKT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -