H00000734-M02

OSGIN2 antibody from Abnova Corporation
C8orf1, hT41
No application information provided.

Antibody data

Product number
H00000734-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000734-M02, RRID:AB_1204043
Product name
C8orf1 monoclonal antibody (M02), clone 3E11
Provider product page
Abnova Corporation - H00000734-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant C8orf1.
Antigen sequence
SGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHK
SSQPITCKGNPVEIDTYTYECIKEANLFALGPLVG
DNFVRFLKGGALGVTRCLATRQKKKHLFVERGGGD
GIA
Isotype
IgG
Antibody clone number
3E11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -