HPA012150

C19orf38 antibody from Sigma-Aldrich
HIDE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012150
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012150, RRID:AB_10603448
Product name
Anti-C19orf38 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012150
Antibody type
Polyclonal
Antigen
Protein HIDE1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KDRESCWAQINFDSTDMSFDNSLFTVSAKTMPEED
PATLDDHSGTTATPSNSRTRKRPTSTSSSPETPEF
STFRACQ
Storage
-20C
Provider Type Product Number
- No reagents -