HPA011424

RNF149 antibody from Sigma-Aldrich
FLJ90504
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011424
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011424, RRID:AB_1079825
Product name
Anti-RNF149 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011424
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase RNF149 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRI
LPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGY
WGEPGDVQEMPAPESPPGRDPAANLSLALPDDDGS
DESSPPSASPAESEPQCDPSFKGDAGENT
Storage
-20C
Provider Type Product Number
- No reagents -