Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA036652 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA036652, RRID:AB_2675229
- Product name
- Anti-IL11RA
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIP
KEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRL
LDHRDS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Hepatocyte-specific IL11 cis-signaling drives lipotoxicity and underlies the transition from NAFLD to NASH
Dong J, Viswanathan S, Adami E, Singh B, Chothani S, Ng B, Lim W, Zhou J, Tripathi M, Ko N, Shekeran S, Tan J, Lim S, Wang M, Lio P, Yen P, Schafer S, Cook S, Widjaja A
Nature Communications 2021;12(1)
Nature Communications 2021;12(1)
No comments: Submit comment
No validations: Submit validation data