Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405826 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Interleukin 11 Receptor, alpha (IL11RA) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IL11RA antibody: synthetic peptide directed towards the N terminal of human IL11RA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
QLGYPPARPVVSCQAADYENFSCTWSPSQISGLPT
RYLTS YRKKTVLGAD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression of interleukin-11 (IL-11) and IL-11 receptor alpha in human gastric carcinoma and IL-11 upregulates the invasive activity of human gastric carcinoma cells.
Nakayama T, Yoshizaki A, Izumida S, Suehiro T, Miura S, Uemura T, Yakata Y, Shichijo K, Yamashita S, Sekin I
International journal of oncology 2007 Apr;30(4):825-33
International journal of oncology 2007 Apr;30(4):825-33
No comments: Submit comment
No validations: Submit validation data