Antibody data

Product number
ABIN405826
Provider
antibodies-online
Product name
anti-Interleukin 11 Receptor, alpha (IL11RA) (N-Term) antibody
Provider product page
antibodies-online - ABIN405826
Antibody type
Polyclonal
Antigen
The immunogen for anti-IL11RA antibody: synthetic peptide directed towards the N terminal of human IL11RA
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian
Host
Rabbit
Antigen sequence
QLGYPPARPVVSCQAADYENFSCTWSPSQISGLPT
RYLTS YRKKTVLGAD
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -