Antibody data

Product number
H00006756-M01
Provider
Abnova Corporation
Product name
SSX1 monoclonal antibody (M01), clone 5B2
Provider product page
Abnova Corporation - H00006756-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SSX1.
Antigen sequence
NRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDS
KGVSEASGPQNDGKQLHPPGKANISEKINKRSGPK
RGKHAWTHRLRERKQLVIYEEISDPEEDDE
Isotype
IgG
Antibody clone number
5B2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -