HPA000534

DNAJB7 antibody from Sigma-Aldrich
HSC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000534
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000534, RRID:AB_1078693
Product name
Anti-DNAJB7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000534
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily B member 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEE
AERKFKEVAEAYEVLSNDEKRDIYDKYGTEGLNGG
GSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHF
FEDSLEDLLNRPGSSYGNRNRDAGYFFSTASEYP
Storage
-20C
Provider Type Product Number
- No reagents -