Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310968 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Serine/threonine Kinase Receptor Associated Protein (STRAP) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-STRAP antibody: synthetic peptide directed towards the N terminal of human STRAP
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAE
PKEIS GHTSGIKKAL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Regulation of transforming growth factor-beta signaling and PDK1 kinase activity by physical interaction between PDK1 and serine-threonine kinase receptor-associated protein.
Seong HA, Jung H, Choi HS, Kim KT, Ha H
The Journal of biological chemistry 2005 Dec 30;280(52):42897-908
The Journal of biological chemistry 2005 Dec 30;280(52):42897-908
No comments: Submit comment
No validations: Submit validation data