Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311645 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-GID Complex Subunit 4, VID24 Homolog (S. Cerevisiae) (GID4) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C17orf39 antibody: synthetic peptide directed towards the C terminal of human C17orf39
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
WDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEEL
KNGDY VFMRWKEQFL- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse.
Bi W, Yan J, Stankiewicz P, Park SS, Walz K, Boerkoel CF, Potocki L, Shaffer LG, Devriendt K, Nowaczyk MJ, Inoue K, Lupski JR
Genome research 2002 May;12(5):713-28
Genome research 2002 May;12(5):713-28
No comments: Submit comment
No validations: Submit validation data