HPA013323

FCRL1 antibody from Sigma-Aldrich
CD307a, FCRH1, IFGP1, IRTA5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013323
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013323, RRID:AB_1848480
Product name
Anti-FCRL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013323
Antibody type
Polyclonal
Antigen
Fc receptor-like protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVP
VADVSLETQPPGGQVMEGDRLVLICSVAMGTGDIT
FLWYKGAVGLNLQSKTQRSL
Storage
-20C
Provider Type Product Number
- No reagents -