Antibody data

Product number
H00023412-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023412-M01, RRID:AB_1574066
Product name
COMMD3 monoclonal antibody (M01), clone 2E2
Provider product page
Abnova Corporation - H00023412-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant COMMD3.
Antigen sequence
MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQS
LLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYI
LEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQ
NNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQ
LHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQL
QDLVGKLKDASKSLERATQS
Isotype
IgG
Antibody clone number
2E2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -